PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01775g01026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 413aa    MW: 45354.4 Da    PI: 5.5023
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01775g01026.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.22.5e-06444539
                  zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                              +C+ ++e++ + +C+++  +lC +C  + H+       H++
  Peinf101Scf01775g01026.1  4 ICEYCGEQRSIVYCRSDAACLCLSCDRNVHSAnalaqrHSR 44
                              7*****************************65777777776 PP

2zf-B_box24.26.9e-084688440
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                               +C++++++++   C + ++ lC++C  ++H +      H+++
  Peinf101Scf01775g01026.1 46 LICERCNSQPAVVRCIEEKTSLCQSCDWSGHAStsssstHKRQ 88
                              68*****************************778888888875 PP

3CCT61.82.2e-21356399144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               R +a+lRYkeK+ktRkF+K++rY sRKa+A+ R RvKGrFvk+ 
  Peinf101Scf01775g01026.1 356 RSNAVLRYKEKKKTRKFDKQVRYVSRKARADVRRRVKGRFVKAG 399
                               899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.698147IPR000315B-box-type zinc finger
CDDcd000211.17E-7447No hitNo description
SMARTSM003364.9E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501199.3144390IPR000315B-box-type zinc finger
CDDcd000212.38E-54777No hitNo description
SMARTSM003360.914890IPR000315B-box-type zinc finger
PfamPF062031.1E-15356398IPR010402CCT domain
PROSITE profilePS5101714.942356398IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MGYICEYCGE QRSIVYCRSD AACLCLSCDR NVHSANALAQ RHSRTLICER CNSQPAVVRC  60
IEEKTSLCQS CDWSGHASTS SSSTHKRQAL SSYTGCPSAA ELSNIWSFLL DDPSVGDTCE  120
QRMGSMSIND SRSKTSQGPQ GKENLRNMCA AVEASDMYIS DKSTLLMESS MPTLDNKPHN  180
VELPIGSTNS ASLKGCYTVA KGSSLFEDDP FYENLIMDEV DMSIENYEEL FGASLNYPDE  240
LFENENLDGL FGTKDVTGAD SSCRGANTAK GSSTARVNAM QPTCSNAESA DSVMSCKTDS  300
ILCFARQAQN SVSFSNHTEE SSAGDHQDCG ASPMLLMGEP PWGPPYPEIS SPSTSRSNAV  360
LRYKEKKKTR KFDKQVRYVS RKARADVRRR VKGRFVKAGD VYDYDPLSQT RSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755241e-172HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010313684.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_004251549.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE51e-135COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A0V0ILA20.0A0A0V0ILA2_SOLCH; Putative zinc finger protein CONSTANS-LIKE 9-like
TrEMBLM1CT820.0M1CT82_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000741420.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12702468
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-122CONSTANS-like 9